- Product Details
Keywords
- Foxo4 Dri Price
- Foxo4 Dri
- Senolytics
Quick Details
- ProName: Us Warehouse Safe Shipping Pharmaceuti...
- CasNo: 33515-09-2
- Molecular Formula: C57H79N17O15
- Appearance: White fine powder
- Application: Applicated in body building.
- DeliveryTime: 5-7days after you make payment by cour...
- PackAge: 1kg/foil bag, 25kgs/drum
- Port: Xi'an, Beijing, Shanghai
- ProductionCapacity: 5 Kilogram/Week
- Purity: 99.89%
- Storage: Store at room temperature or cooler, i...
- Transportation: We can ship out within 5 days after yo...
- LimitNum: 1 Gram
Superiority
Details
Yinherb FOXO4-D-Retro-Inverso(DRI) Custom peptide Peptide Bulk powder
Name:FOXO4-D-Retro-Inverso(DRI) Custom peptide Senolytics Peptide
acetate (salt), Synthetic luteinizing hormone-releasing factor acetate
Appearance :White powder
Purity (HPLC) >98.0%
Single Impurity(HPLC) :1.0%max
Amino Acid Composition :±10% of theoretical
Peptide Content(N%) :≥80.0%
Water Content(Karl Fischer): ≤8.0%
Acetate Content(HPIC): ≤12.0%
MS(ESI): Consistent
Mass Balance: 95.0~105.0%
Bacterial Endotoxins :≤5EU/mg
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C.
What is FOXO4-D-Retro-Inverso(DRI) Custom Peptide
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
Custom clearance service:
1) By Express:
Normally there is no specical need for the recipient to clear the customs. If the customs has an objection,our rich experienced and peofessional group will help you clear the customs. We can guarantee th shipment 100%.
2) By Air and by Sea:
Our company will cooperate with the recipient to provide relevant file and information in the customs clearance procedure.
Delivery Service:
We can ship out within 5 days after you make payment if it have stock at Lab, We always send all order by DHL, UPS, TNT, FedEx, EMS and other courier with door-door service, take 5 – 7 business days to your door!
Packing:
Carton: 1kg, 2kg, 5kg with Foil bag inside, or as customer's requirment;
Drum: 10kg, 15kg, 25kg with food grade PE nag inside.
Delivery:
Shipping Terms | ||
By Express | By Air | By sea |
Suitable for ≤ 50kg Faster 5-7days High Cost Door to Door Easy Pick Up Goods |
Suitable for ≥ 50kg Fastest: 1-2 days High Cost Airport to Airport Pick Up Goods by Customer |
Suitable for ≥ 500kg Fast: 15-30 days Low Cost Port to Port Pick Up Goods by Customer |
Payment:
Payment terms | Western Union |
Moneygram | |
PayPal | |
Wire Transfer | |
Bitcoin |