Product Certification&
    Enterprise Certification

  • Ms.Kitty Wang
    Tel: 86-29-63332330

  • Mobile:+86 18629570260
  • Tel:86-29-63332330
  • Fax:86-29-63332330
  • URL:http://yinherb.ecer.com
  • Province/state:Shaanxi
  • City:Xi'an
  • Street:No.13 Bridge,Kunming Rd, Hi-tech Zone, Xi'an city, China
  • MaxCard:
Home > Products >  Custom Peptide Pharmaceutical Intermediates Calcitonin Salmon Stock Supply with Us Warehouse Shipping

Custom Peptide Pharmaceutical Intermediates Calcitonin Salmon Stock Supply with Us Warehouse Shipping CAS NO.47931-85-1

  • Min.Order: 1 Gram
  • Payment Terms: L/C,D/A,D/P,T/T,
  • Product Details

Keywords

  • Calcitonin Salmon
  • Peptides Calcitonin Salmon
  • 47931-85-1

Quick Details

  • ProName: Custom Peptide Pharmaceutical Intermed...
  • CasNo: 47931-85-1
  • Molecular Formula: C145H240N44O48S2
  • Appearance: White fine powder
  • Application: Applicated in body building.
  • DeliveryTime: 5-7days after you make payment by cour...
  • PackAge: 1kg/foil bag, 25kgs/drum
  • Port: Xi'an, Beijing, Shanghai
  • ProductionCapacity: 5 Kilogram/Week
  • Purity: 99.89%
  • Storage: Store at room temperature or cooler, i...
  • Transportation: We can ship out within 5 days after yo...
  • LimitNum: 1 Gram

Superiority

 
Xi'an Yinherb Bio-Tech Co., Ltd was founded in 2009, We have more than 10 experienced doctors and scientists and professional managers, specializing in Nootropics, Sarms and Peptides researching and developing, and become the leader manufacturer on all kinds of nootropics powder, we guarantted the every batch quality and give you test report along with order, we always believe "quality is firstly, service is secondly, price is thirdly ", so must build with every customer in an enjoyable business relationship!
 
You are buying = Our Products + Our Service:
1,Quality is our culture ,strict QC/QA systems under GMP factory.
 
2,Fast and safe delivery with secure and discreet shipment.
 
3,With us, your money is in safe as well as your business.It's our promise to you!
 
4,For whatever questions about us or our products you may have, do let us know and you can be assured we reply you in details with 24 hours and to your satisfaction.
 
5,Warmly welcome your visit in our company if available.

 

Details

 

 

Yinherb Supply 98% Pure CAS: 47931-85-1 pure Calcitonin Acetate Salmon
Name: Calcitonin Acetate(Salmon)
Cas No: 47931-85-1(net)
Formula: C145H240N44O48S2
Molecular: 3431.85
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,
Pramlintide, Pramlintide acetate [USAN],187887-46-3,196078-30-5.
Purity:98%
Source: synthetic
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C. 

 

What is Calcitonin Salmon Acetate
Calcitonin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.

Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems.

The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.

Calcitonin Salmon Acetate Benefits
Salmon calcitonin, inhibit the activity of osteoclasts,Inhibit bone salt dissolving, prevent bone calcium release;Improve bone mineral density, effectively relieve pain symptoms;Reduce the risk of fractures;Lower blood calcium.

 

Other Cosmetic Peptide:

Matrixyl3000
Copper Peptide
Oligopeptide-1
Carnosine
Acetyl Hexapeptide-8
Acetyl Hexapeptide-49
Acetyl Hexapeptide-38
Pentapeptide-18
Pentapeptide-3
Hexapeptide-10
Hexapeptide-9
Palmitoyl Trieptide-1
Palmitoyl Tripeptide-8
Palmitoyl Tripeptide-38

MORE ...... 

 

 

 

 

Custom clearance service:

1) By Express:
Normally there is no specical need for the recipient to clear the customs. If the customs has an objection,our rich experienced and peofessional group will help you clear the customs. We can guarantee th shipment 100%.
2) By Air and by Sea:
Our company will cooperate with the recipient to provide relevant file and information in the customs clearance procedure.

 

Delivery Service:

We can ship out within 5 days after you make payment if it have stock at Lab, We always send all order by DHL, UPS, TNT, FedEx, EMS and other courier with door-door service, take 5 – 7 business days to your door!

 

Packing:

Carton: 1kg, 2kg, 5kg with Foil bag inside, or as customer's requirment;

Drum: 10kg, 15kg, 25kg with food grade PE nag inside.

 

 

Delivery:

Shipping Terms
By Express By Air By sea

Suitable for ≤ 50kg   

Faster 5-7days              

High Cost                

Door to Door              

Easy Pick Up Goods

Suitable for ≥ 50kg   

Fastest: 1-2 days               

High Cost                

Airport to Airport      

Pick Up Goods by Customer             

Suitable for ≥ 500kg   

Fast: 15-30 days               

Low Cost                

Port to Port           

Pick Up Goods by Customer


Payment:

Payment terms Western Union
Moneygram
PayPal
Wire Transfer
Bitcoin

 

 
Q1: Can i get some samples 
A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.
 
Q2: How to start orders or make payments 
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information. Payment by T/T, or Paypal or Escrow(Alibaba).
 
Q3: How to confirm the Product Quality before placing orders 
A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.
 
Q4:What’s your MOQ 
A:Our MOQ is 1kg. But usually we accept less quantity such as 100g on the condition that sample charge is 100% paid.
 
Q5: How about delivery leadtime 
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)
 
Q6:Is there a discount 
A:Different quantity has different discount.
 
Q7: How do you treat quality complaint 
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.
 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog