Weight Loss Cetilistat, Orlistat, Lorcaserin, Rimonabant, Metformin, Liraglutide, Exenatide, Lorcaserin HCl CAS: 141732-76-5 CAS NO.141732-76-5

Yinherb Supply 98% pure Exenatida/Exenatide Acetate peptide powder for sale CAS: 141732-76-5 
Name:Exenatide Acetate, Exenatida      
Cas No:141732-76-5
Formula: C186H286N50O62S
Molecular:4246.62
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Purity:98%
Appearance: white powder
Source: synthetic
Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C. 

What is Exenatide Acetate
Exendin-4 (exenatide), a 39-amino acid peptide originally isolated from the salivary glands of the Gila monster (Heloderma suspectum), differs from exendin-3 only in two positions close to the N-terminus. Application of exenatide causes an increase in acinar cAMP without stimulating amylase release. As an incretin mimetic, exenatide acts as agonist of the glucagon-like peptide-1 (GLP-1) receptor. As GLP-1, though with prolonged activity, exenatide augments the postprandial production of and suppresses secretion of glucagon. For this reason, exenatide has found use as a medication of diabetes II.

Exenatide Acetate Benefits
1. Exenatide augments pancreas response and more appropriate amount of that helps lower the rise in blood sugar from eating.
2. Exenatide also suppresses pancreatic release of glucagon, which prevents hyperglycemia (high blood sugar levels).
3. Exenatide helps slow down gastric emptying and thus decreases the rate at which meal-derived glucose appears in the bloodstream.
4. Exenatide has a subtle yet prolonged effect to reduce appetite, promote satiety via hypothalamic receptors.
5. Exenatide reduces liver fat content. Fat accumulation in the liver or nonalcoholic fatty liver disease (NAFLD) is strongly related with several metabolic disorders.
 

Custom clearance service:

1) By Express:
Normally there is no specical need for the recipient to clear the customs. If the customs has an objection,our rich experienced and peofessional group will help you clear the customs. We can guarantee th shipment 100%.
2) By Air and by Sea:
Our company will cooperate with the recipient to provide relevant file and information in the customs clearance procedure.

Delivery Service:

We can ship out within 5 days after you make payment if it have stock at Lab, We always send all order by DHL, UPS, TNT, FedEx, EMS and other courier with door-door service, take 5 – 7 business days to your door!

Packing:

Carton: 1kg, 2kg, 5kg with Foil bag inside, or as customer's requirment;

Drum: 10kg, 15kg, 25kg with food grade PE nag inside.

Delivery:

Payment: