China (Mainland)
Premiumsupplier 
Yinherb Lab Supply 98% Pure CAS: 47931-85-1 Pure Calcitonin Acetate Salmon Calcitonin Salmon CAS NO.47931-85-1
- Min.Order: 1 Gram
- Payment Terms: L/C,D/A,D/P,T/T,
- Product Details
Keywords
- Calcitonin Salmon
- Peptides Calcitonin Salmon
- 47931-85-1
Quick Details
- ProName: Yinherb Lab Supply 98% Pure CAS: 47931...
- CasNo: 47931-85-1
- Molecular Formula: C145H240N44O48S2
- Appearance: White fine powder
- Application: Applicated in body building.
- DeliveryTime: 5-7days after you make payment by cour...
- PackAge: 1kg/foil bag, 25kgs/drum
- Port: Xi'an, Beijing, Shanghai
- ProductionCapacity: 5 Kilogram/Week
- Purity: 99.89%
- Storage: Store at room temperature or cooler, i...
- Transportation: We can ship out within 5 days after yo...
- LimitNum: 1 Gram
Superiority
Details
Yinherb Supply 98% Pure CAS: 47931-85-1 pure Calcitonin Acetate Salmon
Name: Calcitonin Acetate(Salmon)
Cas No: 47931-85-1(net)
Formula: C145H240N44O48S2
Molecular: 3431.85
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,
Pramlintide, Pramlintide acetate [USAN],187887-46-3,196078-30-5.
Purity:98%
Source: synthetic
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C.
|
|
|
What is Calcitonin Salmon Acetate
Calcitonin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems.
The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.
Calcitonin Salmon Acetate Benefits
Salmon calcitonin, inhibit the activity of osteoclasts,Inhibit bone salt dissolving, prevent bone calcium release;Improve bone mineral density, effectively relieve pain symptoms;Reduce the risk of fractures;Lower blood calcium.
Matrixyl3000
Copper Peptide
Oligopeptide-1
Carnosine
Acetyl Hexapeptide-8
Acetyl Hexapeptide-49
Acetyl Hexapeptide-38
Pentapeptide-18
Pentapeptide-3
Hexapeptide-10
Hexapeptide-9
Palmitoyl Trieptide-1
Palmitoyl Tripeptide-8
Palmitoyl Tripeptide-38
MORE ......
Custom clearance service:
1) By Express:
Normally there is no specical need for the recipient to clear the customs. If the customs has an objection,our rich experienced and peofessional group will help you clear the customs. We can guarantee th shipment 100%.
2) By Air and by Sea:
Our company will cooperate with the recipient to provide relevant file and information in the customs clearance procedure.
Delivery Service:
We can ship out within 5 days after you make payment if it have stock at Lab, We always send all order by DHL, UPS, TNT, FedEx, EMS and other courier with door-door service, take 5 – 7 business days to your door!
Packing:
Carton: 1kg, 2kg, 5kg with Foil bag inside, or as customer's requirment;
Drum: 10kg, 15kg, 25kg with food grade PE nag inside.
Delivery:
| Shipping Terms | ||
| By Express | By Air | By sea |
|
Suitable for ≤ 50kg Faster 5-7days High Cost Door to Door Easy Pick Up Goods |
Suitable for ≥ 50kg Fastest: 1-2 days High Cost Airport to Airport Pick Up Goods by Customer |
Suitable for ≥ 500kg Fast: 15-30 days Low Cost Port to Port Pick Up Goods by Customer |
Payment:
| Payment terms | Western Union |
| Moneygram | |
| PayPal | |
| Wire Transfer | |
| Bitcoin |
